Lineage for d2vlre2 (2vlr E:119-244)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 786831Protein T-cell antigen receptor [49125] (6 species)
  7. 786857Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (28 PDB entries)
  8. 786867Domain d2vlre2: 2vlr E:119-244 [153303]
    Other proteins in same PDB: d2vlra1, d2vlra2, d2vlrb1, d2vlre1, d2vlrf1, d2vlrf2, d2vlrg1, d2vlrj1
    automatically matched to d1ogae2

Details for d2vlre2

PDB Entry: 2vlr (more details), 2.3 Å

PDB Description: the structural dynamics and energetics of an immunodominant t-cell receptor are programmed by its vbeta domain
PDB Compounds: (E:) jm22 tcr beta chain

SCOP Domain Sequences for d2vlre2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vlre2 b.1.1.2 (E:119-244) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
nvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpqplk
eqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsae
awgrad

SCOP Domain Coordinates for d2vlre2:

Click to download the PDB-style file with coordinates for d2vlre2.
(The format of our PDB-style files is described here.)

Timeline for d2vlre2: