Lineage for d2vlre2 (2vlr E:119-244)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749668Protein T-cell antigen receptor [49125] (7 species)
  7. 2749711Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (46 PDB entries)
  8. 2749749Domain d2vlre2: 2vlr E:119-244 [153303]
    Other proteins in same PDB: d2vlra1, d2vlra2, d2vlrb2, d2vlrb3, d2vlre1, d2vlrf1, d2vlrf2, d2vlrg2, d2vlrg3, d2vlrj1
    automatically matched to d1ogae2

Details for d2vlre2

PDB Entry: 2vlr (more details), 2.3 Å

PDB Description: the structural dynamics and energetics of an immunodominant t-cell receptor are programmed by its vbeta domain
PDB Compounds: (E:) jm22 tcr beta chain

SCOPe Domain Sequences for d2vlre2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vlre2 b.1.1.2 (E:119-244) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
nvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpqplk
eqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsae
awgrad

SCOPe Domain Coordinates for d2vlre2:

Click to download the PDB-style file with coordinates for d2vlre2.
(The format of our PDB-style files is described here.)

Timeline for d2vlre2: