Lineage for d2vloa_ (2vlo A:)
- Root: SCOPe 2.05
Class a: All alpha proteins [46456] (286 folds) 
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
4 helices, bundle; helix 3 is shorter than others; up-and-down
Superfamily a.28.2: Colicin E immunity proteins [47345] (2 families) 
automatically mapped to Pfam PF01320Family a.28.2.1: Colicin E immunity proteins [47346] (4 proteins) 
Protein automated matches [190365] (1 species)
not a true proteinSpecies Escherichia coli [TaxId:562] [187200] (5 PDB entries) 
Domain d2vloa_: 2vlo A: [153296]
Other proteins in same PDB: d2vlob_
automated match to d1e0ha_
protein/DNA complex; complexed with so4; mutant
Details for d2vloa_
PDB Entry: 2vlo (more details), 1.8 Å
PDB Description: k97a mutant of e9 dnase domain in complex with im9
PDB Compounds: (A:) colicin-e9 immunity proteinSCOPe Domain Sequences for d2vloa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vloa_ a.28.2.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
khsisdyteaeflqlvtticnadtsseeelvklvthfeemtehpsgsdliyypkegddds
psgivntvkqwraangksgfkqglehhhhh
SCOPe Domain Coordinates for d2vloa_:
Click to download the PDB-style file with coordinates for d2vloa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2vloa_:
- d2vloa_ first appeared in SCOP 1.75, called d2vloa1
- d2vloa_ appears in SCOPe 2.04
- d2vloa_ is called d2vloa2 in SCOPe 2.06
- d2vloa_ appears in the current release, SCOPe 2.08, called d2vloa2
View in 3D
