SCOP 1.75: Domain d2vlme2: 2vlm E:119-244

Lineage for d2vlme2 (2vlm E:119-244)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein T-cell antigen receptor [49125] (6 species)

7. Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (28 PDB entries)

8. Domain d2vlme2: 2vlm E:119-244 [153294]
   Other proteins in same PDB: d2vlme1
   automatically matched to d1ogae2

Details for d2vlme2

PDB Entry: 2vlm, 1.98 Å

PDB Description: the structural dynamics and energetics of an immunodominant t-cell receptor are programmed by its vbeta domain

PDB Compounds: (E:) jm22 tcr beta chain

SCOP Domain Sequences for d2vlme2:

Sequence; same for both SEQRES and ATOM records:

>d2vlme2 b.1.1.2 (E:119-244) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
nvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpqplk
eqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsae
awgrad

Timeline for d2vlme2:

• d2vlme2 is new in SCOP 1.75
  
• d2vlme2 appears in SCOPe 2.01
  
• d2vlme2 appears in the current release, SCOPe 2.08