Lineage for d2vlme1 (2vlm E:5-115)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2365996Domain d2vlme1: 2vlm E:5-115 [153293]
    Other proteins in same PDB: d2vlmd2
    automated match to d3q5ya1

Details for d2vlme1

PDB Entry: 2vlm (more details), 1.98 Å

PDB Description: the structural dynamics and energetics of an immunodominant t-cell receptor are programmed by its vbeta domain
PDB Compounds: (E:) jm22 tcr beta chain

SCOPe Domain Sequences for d2vlme1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vlme1 b.1.1.0 (E:5-115) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gitqspkylfrkegqnvtlsceqnlnhdamywyrqdpgqglrliyysqivndfqkgdiae
gysvsrekkesfpltvtsaqknptafylcasssrssyeqyfgpgtrltvte

SCOPe Domain Coordinates for d2vlme1:

Click to download the PDB-style file with coordinates for d2vlme1.
(The format of our PDB-style files is described here.)

Timeline for d2vlme1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vlme2