Lineage for d2vlme1 (2vlm E:5-118)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1289755Protein T-cell antigen receptor [48933] (6 species)
    sequences may differ within each classified species
  7. 1289783Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (32 PDB entries)
  8. 1289790Domain d2vlme1: 2vlm E:5-118 [153293]
    Other proteins in same PDB: d2vlmd1, d2vlmd2, d2vlme2
    automatically matched to d1ogae1

Details for d2vlme1

PDB Entry: 2vlm (more details), 1.98 Å

PDB Description: the structural dynamics and energetics of an immunodominant t-cell receptor are programmed by its vbeta domain
PDB Compounds: (E:) jm22 tcr beta chain

SCOPe Domain Sequences for d2vlme1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vlme1 b.1.1.1 (E:5-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
gitqspkylfrkegqnvtlsceqnlnhdamywyrqdpgqglrliyysqivndfqkgdiae
gysvsrekkesfpltvtsaqknptafylcasssrssyeqyfgpgtrltvtedlk

SCOPe Domain Coordinates for d2vlme1:

Click to download the PDB-style file with coordinates for d2vlme1.
(The format of our PDB-style files is described here.)

Timeline for d2vlme1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vlme2