| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) ![]() |
| Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins) |
| Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species) |
| Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (76 PDB entries) Uniprot P01892 25-298 |
| Domain d2vlld2: 2vll D:1-181 [153291] Other proteins in same PDB: d2vlla1, d2vllb1, d2vlld1, d2vlle1 automatically matched to d1akja2 |
PDB Entry: 2vll (more details), 1.6 Å
SCOP Domain Sequences for d2vlld2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vlld2 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r
Timeline for d2vlld2:
View in 3DDomains from other chains: (mouse over for more information) d2vlla1, d2vlla2, d2vllb1, d2vlle1 |