SCOPe 2.06: Domain d2vlke2: 2vlk E:119-244

Lineage for d2vlke2 (2vlk E:119-244)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein T-cell antigen receptor [49125] (7 species)

7. Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (29 PDB entries)

8. Domain d2vlke2: 2vlk E:119-244 [153286]
   Other proteins in same PDB: d2vlka1, d2vlka2, d2vlkb2, d2vlkb3, d2vlke1
   automatically matched to d1ogae2

Details for d2vlke2

PDB Entry: 2vlk, 2.5 Å

PDB Description: the structural dynamics and energetics of an immunodominant t-cell receptor are programmed by its vbeta domain

PDB Compounds: (E:) jm22 tcr beta chain

SCOPe Domain Sequences for d2vlke2:

Sequence; same for both SEQRES and ATOM records:

>d2vlke2 b.1.1.2 (E:119-244) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
nvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpqplk
eqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsae
awgrad

Timeline for d2vlke2:

• d2vlke2 first appeared in SCOP 1.75
  
• d2vlke2 appears in SCOPe 2.05
  
• d2vlke2 appears in SCOPe 2.07
  
• d2vlke2 appears in the current release, SCOPe 2.08