| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins) |
| Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
| Species Human (Homo sapiens), beta-chain [TaxId:9606] [48937] (30 PDB entries) |
| Domain d2vlke1: 2vlk E:5-118 [153285] Other proteins in same PDB: d2vlka1, d2vlka2, d2vlkb1, d2vlke2 automatically matched to d1ogae1 |
PDB Entry: 2vlk (more details), 2.5 Å
SCOP Domain Sequences for d2vlke1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vlke1 b.1.1.1 (E:5-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
gitqspkylfrkegqnvtlsceqnlnhdamywyrqdpgqglrliyysqivndfqkgdiae
gysvsrekkesfpltvtsaqknptafylcasssrssyeqyfgpgtrltvtedlk
Timeline for d2vlke1: