Lineage for d2vlje2 (2vlj E:119-244)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 931881Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 935079Protein T-cell antigen receptor [49125] (6 species)
  7. 935105Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (28 PDB entries)
  8. 935113Domain d2vlje2: 2vlj E:119-244 [153281]
    Other proteins in same PDB: d2vlja1, d2vlja2, d2vljb_, d2vlje1
    automatically matched to d1ogae2

Details for d2vlje2

PDB Entry: 2vlj (more details), 2.4 Å

PDB Description: the structural dynamics and energetics of an immunodominant t-cell receptor are programmed by its vbeta domain
PDB Compounds: (E:) jm22 tcr beta chain

SCOPe Domain Sequences for d2vlje2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vlje2 b.1.1.2 (E:119-244) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]}
nvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpqplk
eqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsae
awgrad

SCOPe Domain Coordinates for d2vlje2:

Click to download the PDB-style file with coordinates for d2vlje2.
(The format of our PDB-style files is described here.)

Timeline for d2vlje2: