Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein T-cell antigen receptor [49125] (6 species) |
Species Human (Homo sapiens), beta-chain [TaxId:9606] [49129] (28 PDB entries) |
Domain d2vlje2: 2vlj E:119-244 [153281] Other proteins in same PDB: d2vlja1, d2vlja2, d2vljb_, d2vlje1 automatically matched to d1ogae2 |
PDB Entry: 2vlj (more details), 2.4 Å
SCOPe Domain Sequences for d2vlje2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vlje2 b.1.1.2 (E:119-244) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} nvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvstdpqplk eqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsae awgrad
Timeline for d2vlje2: