Lineage for d2vl8c_ (2vl8 C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133931Family c.68.1.22: Glycosylating toxin catalytic domain-like [159726] (4 protein domains)
    contains Glycosyltransferase sugar-binding region containing DXD motif, Pfam PF04488
  6. 2133942Protein automated matches [190532] (3 species)
    not a true protein
  7. 2133945Species Clostridium sordellii [TaxId:1505] [188384] (3 PDB entries)
  8. 2133948Domain d2vl8c_: 2vl8 C: [153268]
    automated match to d2bvla1
    complexed with ca, cts, udp

Details for d2vl8c_

PDB Entry: 2vl8 (more details), 2.31 Å

PDB Description: crystal structure of the catalytic domain of lethal toxin from clostridium sordellii in complex with udp, castanospermine and calcium ion
PDB Compounds: (C:) cytotoxin l

SCOPe Domain Sequences for d2vl8c_:

Sequence, based on SEQRES records: (download)

>d2vl8c_ c.68.1.22 (C:) automated matches {Clostridium sordellii [TaxId: 1505]}
mnlvnkaqlqkmayvkfriqedeyvailnaleeyhnmsessvvekylklkdinnltdnyl
ntykksgrnkalkkfkeyltmevlelknnsltpveknlhfiwiggqindtainyinqwkd
vnsdytvkvfydsnaflintlkktivesatnntlesfrenlndpefdynkfyrkrmeiiy
dkqkhfidyyksqieenpefiidniiktylsneyskdlealnkyieeslnkitanngndi
rnlekfadedlvrlynqelverwnlaaasdilrismlkedggvyldvdmlpgiqpdlfks
inkpdsitntswemikleaimkykeyipgytsknfdmldeevqrsfesalssksdkseif
lplddikvsplevkiafannsvinqalislkdsycsdlvinqiknrykilndnlnpsine
gtdfnttmkifsdklasisnednmmfmikitnylkvgfapdvrstinlsgpgvytgayqd
llmfkdnstnihllepelrnfefpktkisqlteqeitslwsfnqaraksqfeeykkgyfe
g

Sequence, based on observed residues (ATOM records): (download)

>d2vl8c_ c.68.1.22 (C:) automated matches {Clostridium sordellii [TaxId: 1505]}
mnlvnkaqlqkmayvkfriqedeyvailnaleeyhnmsessvvekylklkdinnltdnyl
ntykksgrnkalkkfkeyltmevlelknnsltpveknlhfiwiggqindtainyinqwkd
vnsdytvkvfydsnaflintlkktivesatnntlesfrenlndpefdynkfyrkrmeiiy
dkqkhfidyyksqieenpefiidniiktylsneyskdlealnkyieeslnkitanngndi
rnlekfadedlvrlynqelverwnlaaasdilrismlkedggvyldvdmlpgiqpdlfks
inkpdsitntswemikleaimkykeyipgytsknfdmldeevqrsfesalssksdkseif
lplddikvsplevkiafannsvinqalislkdsycsdlvinqiknrykilndnlnpsine
gtdfnttmkifsdklasisnednmmfmikitnylkvgfapdvrstinlsgpgvytgayqd
llmfkdnstnihllepelrnfefpktkisqlteqeitslwaraksqfeeykkgyfeg

SCOPe Domain Coordinates for d2vl8c_:

Click to download the PDB-style file with coordinates for d2vl8c_.
(The format of our PDB-style files is described here.)

Timeline for d2vl8c_: