Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
Protein automated matches [190057] (21 species) not a true protein |
Species Bacteroides thetaiotaomicron [TaxId:226186] [255614] (7 PDB entries) |
Domain d2vl4b5: 2vl4 B:331-678 [153263] Other proteins in same PDB: d2vl4a1, d2vl4a2, d2vl4a3, d2vl4a4, d2vl4b1, d2vl4b2, d2vl4b3, d2vl4b4 automated match to d2je8a5 complexed with br, cl, edo, mnm |
PDB Entry: 2vl4 (more details), 1.9 Å
SCOPe Domain Sequences for d2vl4b5:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vl4b5 c.1.8.3 (B:331-678) automated matches {Bacteroides thetaiotaomicron [TaxId: 226186]} rtirvvnekdkdgesfyfevngipmfakganyipqdallpnvtteryqtlfrdmkeanmn mvriwgggtyennlfydladengilvwqdfmfactpypsdptflkrveaeavynirrlrn haslamwcgnneilealkywgfekkftpevyqglmhgydklfrellpstvkefdsdrfyv hsspylanwgrpeswgtgdshnwgvwygkkpfesldtdlprfmsefgfqsfpemktiaaf aapedyqiesevmnahqkssignslirtymerdyiipesfedfvyvglvlqgqgmrhgle ahrrnrpycmgtlywqlndswpvvswssidyygnwkalhyqakrafap
Timeline for d2vl4b5: