![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) ![]() |
![]() | Family c.1.8.3: beta-glycanases [51487] (26 proteins) consist of a number of sequence families |
![]() | Protein Five-domain beta-mannosidase, domain 3 [159385] (1 species) |
![]() | Species Bacteroides thetaiotaomicron [TaxId:818] [159386] (9 PDB entries) Uniprot Q8AAK6 330-678! Uniprot Q8AAK6 331-678 |
![]() | Domain d2vl4b5: 2vl4 B:331-678 [153263] Other proteins in same PDB: d2vl4a1, d2vl4a2, d2vl4a3, d2vl4a4, d2vl4b1, d2vl4b2, d2vl4b3, d2vl4b4 automatically matched to 2JE8 A:331-678 complexed with br, cl, edo, noz |
PDB Entry: 2vl4 (more details), 1.9 Å
SCOP Domain Sequences for d2vl4b5:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vl4b5 c.1.8.3 (B:331-678) Five-domain beta-mannosidase, domain 3 {Bacteroides thetaiotaomicron [TaxId: 818]} rtirvvnekdkdgesfyfevngipmfakganyipqdallpnvtteryqtlfrdmkeanmn mvriwgggtyennlfydladengilvwqdfmfactpypsdptflkrveaeavynirrlrn haslamwcgnneilealkywgfekkftpevyqglmhgydklfrellpstvkefdsdrfyv hsspylanwgrpeswgtgdshnwgvwygkkpfesldtdlprfmsefgfqsfpemktiaaf aapedyqiesevmnahqkssignslirtymerdyiipesfedfvyvglvlqgqgmrhgle ahrrnrpycmgtlywqlndswpvvswssidyygnwkalhyqakrafap
Timeline for d2vl4b5: