Lineage for d2vl4b2 (2vl4 B:784-864)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 787894Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) (S)
  5. 787895Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins)
  6. 788179Protein Beta-mannosidase, domains 2, 4 and 5 [158905] (1 species)
    truncated domain 5 lacks the last strand
  7. 788180Species Bacteroides thetaiotaomicron [TaxId:818] [158906] (9 PDB entries)
    Uniprot Q8AAK6 220-330! Uniprot Q8AAK6 679-783! Uniprot Q8AAK6 784-864
  8. 788203Domain d2vl4b2: 2vl4 B:784-864 [153260]
    Other proteins in same PDB: d2vl4a4, d2vl4a5, d2vl4b4, d2vl4b5
    automatically matched to 2JE8 A:784-864
    complexed with br, cl, edo, noz

Details for d2vl4b2

PDB Entry: 2vl4 (more details), 1.9 Å

PDB Description: structural and biochemical evidence for a boat-like transition state in beta-mannosidases
PDB Compounds: (B:) beta-mannosidase

SCOP Domain Sequences for d2vl4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vl4b2 b.1.4.1 (B:784-864) Beta-mannosidase, domains 2, 4 and 5 {Bacteroides thetaiotaomicron [TaxId: 818]}
lpptsvsyqmkqtdgkceltlfssmlakdifietplqgarysdnffdllpgerkkviits
prikkgeelpvnikhiretyk

SCOP Domain Coordinates for d2vl4b2:

Click to download the PDB-style file with coordinates for d2vl4b2.
(The format of our PDB-style files is described here.)

Timeline for d2vl4b2: