Lineage for d2vl4a4 (2vl4 A:28-219)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 792799Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 792800Superfamily b.18.1: Galactose-binding domain-like [49785] (32 families) (S)
  5. 792873Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins)
  6. 793019Protein Beta-mannosidase [158959] (1 species)
  7. 793020Species Bacteroides thetaiotaomicron [TaxId:818] [158960] (9 PDB entries)
    Uniprot Q8AAK6 28-219
  8. 793027Domain d2vl4a4: 2vl4 A:28-219 [153257]
    Other proteins in same PDB: d2vl4a1, d2vl4a2, d2vl4a3, d2vl4a5, d2vl4b1, d2vl4b2, d2vl4b3, d2vl4b5
    automatically matched to 2JE8 A:28-219
    complexed with br, cl, edo, noz

Details for d2vl4a4

PDB Entry: 2vl4 (more details), 1.9 Å

PDB Description: structural and biochemical evidence for a boat-like transition state in beta-mannosidases
PDB Compounds: (A:) beta-mannosidase

SCOP Domain Sequences for d2vl4a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vl4a4 b.18.1.5 (A:28-219) Beta-mannosidase {Bacteroides thetaiotaomicron [TaxId: 818]}
ndtsevmlldtgwefsqsgtekwmpatvpgtvhqdlishellpnpfygmnekkiqwvene
dweyrtsfivseeqlnrdgiqlifegldtyadvylngslllkadnmfvgytlpvksvlrk
genhlyiyfhspirqtlpqyasngfnypadndhhekhlsvfsrkapysygwdwgirmvts
gvwrpvtlrfyd

SCOP Domain Coordinates for d2vl4a4:

Click to download the PDB-style file with coordinates for d2vl4a4.
(The format of our PDB-style files is described here.)

Timeline for d2vl4a4: