Lineage for d2vl2c_ (2vl2 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877441Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2877880Protein automated matches [190100] (21 species)
    not a true protein
  7. 2878164Species Human (Homo sapiens) [TaxId:9606] [187259] (21 PDB entries)
  8. 2878213Domain d2vl2c_: 2vl2 C: [153250]
    Other proteins in same PDB: d2vl2a3
    automated match to d1oc3a_
    complexed with bez

Details for d2vl2c_

PDB Entry: 2vl2 (more details), 1.93 Å

PDB Description: oxidized and reduced forms of human peroxiredoxin 5
PDB Compounds: (C:) peroxiredoxin-5

SCOPe Domain Sequences for d2vl2c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vl2c_ c.47.1.10 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apikvgdaipavevfegepgnkvnlaelfkgkkgvlfgvpgaftpgcskthlpgfveqae
alkakgvqvvaclsvndafvtgewgrahkaegkvrlladptgafgketdlllddslvsif
gnrrlkrfsmvvqdgivkalnvepdgtgltcslapniisql

SCOPe Domain Coordinates for d2vl2c_:

Click to download the PDB-style file with coordinates for d2vl2c_.
(The format of our PDB-style files is described here.)

Timeline for d2vl2c_: