SCOP 1.75: Domain d2vkxe2: 2vkx E:601-693

Lineage for d2vkxe2 (2vkx E:601-693)

Root: SCOP 1.75
Class b: All beta proteins [48724] (174 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.2: Fibronectin type III [49265] (1 family)
Family b.1.2.1: Fibronectin type III [49266] (44 proteins)
Pfam PF00041
Protein Neural cell adhesion molecule 1, NCAM [89197] (2 species)
Species Human (Homo sapiens) [TaxId:9606] [141033] (3 PDB entries)
Uniprot P13592 498-598
Domain d2vkxe2: 2vkx E:601-693 [153245]
automatically matched to d1lwra_
complexed with so4; mutant

Details for d2vkxe2

PDB Entry: 2vkx (more details), 2.7 Å

PDB Description: human ncam, fn3 domains 1 and 2, m610r mutant

PDB Compounds: (E:) neural cell adhesion molecule

SCOP Domain Sequences for d2vkxe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vkxe2 b.1.2.1 (E:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]}
psapklegqrgedgnsikvnlikqddggspirhylvryralssewkpeirlpsgsdhvml
ksldwnaeyevyvvaenqqgkskaahfvfrtaa

SCOP Domain Coordinates for d2vkxe2:

Click to download the PDB-style file with coordinates for d2vkxe2.
(The format of our PDB-style files is described here.)

Timeline for d2vkxe2: