Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (1 family) |
Family b.1.2.1: Fibronectin type III [49266] (44 proteins) Pfam PF00041 |
Protein Neural cell adhesion molecule 1, NCAM [89197] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [141033] (3 PDB entries) Uniprot P13592 498-598 |
Domain d2vkxb1: 2vkx B:498-598 [153238] automatically matched to d2haza1 complexed with so4; mutant |
PDB Entry: 2vkx (more details), 2.7 Å
SCOP Domain Sequences for d2vkxb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vkxb1 b.1.2.1 (B:498-598) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} dtpsspsidqvepysstaqvqfdepeatggvpilkykaewravgeevwhskwydakeasm egivtivglkpettyavrlaalngkglgeisaasefktqpv
Timeline for d2vkxb1: