SCOP 1.75: Domain d2vkwb1: 2vkw B:498-598

Lineage for d2vkwb1 (2vkw B:498-598)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (1 family)

5. Family b.1.2.1: Fibronectin type III [49266] (44 proteins)
   Pfam PF00041

6. Protein Neural cell adhesion molecule 1, NCAM [89197] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [141033] (3 PDB entries)
   Uniprot P13592 498-598

8. Domain d2vkwb1: 2vkw B:498-598 [153234]
   automatically matched to d2haza1
   complexed with so4

Details for d2vkwb1

PDB Entry: 2vkw, 2.3 Å

PDB Description: human ncam, fn3 domains 1 and 2

PDB Compounds: (B:) Neural Cell Adhesion Molecule 1, 140 kDa isoform

SCOP Domain Sequences for d2vkwb1:

Sequence; same for both SEQRES and ATOM records:

>d2vkwb1 b.1.2.1 (B:498-598) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]}
dtpsspsidqvepysstaqvqfdepeatggvpilkykaewravgeevwhskwydakeasm
egivtivglkpettyavrlaalngkglgeisaasefktqpv

Timeline for d2vkwb1:

• d2vkwb1 is new in SCOP 1.75
  
• d2vkwb1 appears in SCOPe 2.01
  
• d2vkwb1 appears in the current release, SCOPe 2.08