Lineage for d2vkwa2 (2vkw A:601-693)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 787437Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 787438Family b.1.2.1: Fibronectin type III [49266] (44 proteins)
    Pfam PF00041
  6. 787793Protein Neural cell adhesion molecule 1, NCAM [89197] (2 species)
  7. 787794Species Human (Homo sapiens) [TaxId:9606] [141033] (3 PDB entries)
    Uniprot P13592 498-598
  8. 787797Domain d2vkwa2: 2vkw A:601-693 [153233]
    automatically matched to d1lwra_
    complexed with so4

Details for d2vkwa2

PDB Entry: 2vkw (more details), 2.3 Å

PDB Description: human ncam, fn3 domains 1 and 2
PDB Compounds: (A:) Neural Cell Adhesion Molecule 1, 140 kDa isoform

SCOP Domain Sequences for d2vkwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]}
psapklegqmgedgnsikvnlikqddggspirhylvryralssewkpeirlpsgsdhvml
ksldwnaeyevyvvaenqqgkskaahfvfrtaa

SCOP Domain Coordinates for d2vkwa2:

Click to download the PDB-style file with coordinates for d2vkwa2.
(The format of our PDB-style files is described here.)

Timeline for d2vkwa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vkwa1