Lineage for d2vkva2 (2vkv A:68-205)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
multihelical; interlocked (homo)dimerSuperfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) 
Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) 
Protein automated matches [226970] (6 species)
not a true protein
Species Escherichia coli [TaxId:562] [226229] (9 PDB entries) 
Domain d2vkva2: 2vkv A:68-205 [153231]
Other proteins in same PDB: d2vkva1
automated match to d2xpwa2
complexed with mg, tdc
Details for d2vkva2
PDB Entry: 2vkv (more details), 1.74 Å
PDB Description: tetr (bd) variant l17g with reverse phenotype
PDB Compounds: (A:) tetracycline repressor protein class b from transposon tn10, tetracycline repressor protein class dSCOPe Domain Sequences for d2vkva2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vkva2 a.121.1.1 (A:68-205) automated matches {Escherichia coli [TaxId: 562]}
lpaageswqsflrnnamsfrrallryrdgakvhlgtrpdekqydtvetqlrfmtengfsl
rdglyaisavshftlgavleqqehtaaltdrpaapdenlppllrealqimdsddgeqafl
hgleslirgfevqltall
SCOPe Domain Coordinates for d2vkva2:
Click to download the PDB-style file with coordinates for d2vkva2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2vkva2:
- d2vkva2 first appeared in SCOP 1.75
- d2vkva2 appears in SCOPe 2.07
View in 3D
