SCOPe 2.08: Domain d2vkva1: 2vkv A:6-67

Lineage for d2vkva1 (2vkv A:6-67)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.0: automated matches [191447] (1 protein)
   not a true family

6. Protein automated matches [190674] (25 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [226228] (11 PDB entries)

8. Domain d2vkva1: 2vkv A:6-67 [153230]
   Other proteins in same PDB: d2vkva2
   automated match to d1a6ia1
   complexed with mg, tdc

Details for d2vkva1

PDB Entry: 2vkv, 1.74 Å

PDB Description: tetr (bd) variant l17g with reverse phenotype

PDB Compounds: (A:) tetracycline repressor protein class b from transposon tn10, tetracycline repressor protein class d

SCOPe Domain Sequences for d2vkva1:

Sequence; same for both SEQRES and ATOM records:

>d2vkva1 a.4.1.0 (A:6-67) automated matches {Escherichia coli [TaxId: 562]}
kskvinsalelgnevgieglttrklaqklgveqptlywhvknkralldalaveilarhhd
ys

Timeline for d2vkva1:

• d2vkva1 first appeared in SCOP 1.75
  
• d2vkva1 appears in SCOPe 2.07