Lineage for d2vkva1 (2vkv A:6-67)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692712Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 2692713Protein automated matches [190674] (25 species)
    not a true protein
  7. 2692752Species Escherichia coli [TaxId:562] [226228] (11 PDB entries)
  8. 2692756Domain d2vkva1: 2vkv A:6-67 [153230]
    Other proteins in same PDB: d2vkva2
    automated match to d1a6ia1
    complexed with mg, tdc

Details for d2vkva1

PDB Entry: 2vkv (more details), 1.74 Å

PDB Description: tetr (bd) variant l17g with reverse phenotype
PDB Compounds: (A:) tetracycline repressor protein class b from transposon tn10, tetracycline repressor protein class d

SCOPe Domain Sequences for d2vkva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vkva1 a.4.1.0 (A:6-67) automated matches {Escherichia coli [TaxId: 562]}
kskvinsalelgnevgieglttrklaqklgveqptlywhvknkralldalaveilarhhd
ys

SCOPe Domain Coordinates for d2vkva1:

Click to download the PDB-style file with coordinates for d2vkva1.
(The format of our PDB-style files is described here.)

Timeline for d2vkva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2vkva2