Lineage for d2vkua_ (2vku A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005432Protein automated matches [190068] (9 species)
    not a true protein
  7. 2005494Species Mycobacterium tuberculosis [TaxId:83332] [187210] (6 PDB entries)
  8. 2005500Domain d2vkua_: 2vku A: [153229]
    automated match to d1e9xa_
    complexed with dbe, hem, so4

Details for d2vkua_

PDB Entry: 2vku (more details), 1.95 Å

PDB Description: 4,4'-dihydroxybenzophenone mimics sterol substrate in the binding site of sterol 14alpha-demethylase (cyp51) in the x-ray structure of the complex
PDB Compounds: (A:) cytochrome p450 51

SCOPe Domain Sequences for d2vkua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vkua_ a.104.1.1 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
lprvsgghdehghleefrtdpiglmqrvrdelgdvgtfqlagkqvvllsgshanefffra
gdddldqakaypfmtpifgegvvfdasperrkemlhnaalrgeqmkghaatiedqvrrmi
adwgeageidlldffaeltiytssacligkkfrdqldgrfaklyhelergtdplayvdpy
lpiesfrrrdearnglvalvadimngrianpptdksdrdmldvliavkaetgtprfsade
itgmfismmfaghhtssgtaswtlielmrhrdayaavideldelygdgrsvsfhalrqip
qlenvlketlrlhppliilmrvakgefevqghrihegdlvaaspaisnripedfpdphdf
vparyeqprqedllnrwtwipfgagrhrcvgaafaimqikaifsvllreyefemaqppes
yrndhskmvvqlaqpaavryrrrtg

SCOPe Domain Coordinates for d2vkua_:

Click to download the PDB-style file with coordinates for d2vkua_.
(The format of our PDB-style files is described here.)

Timeline for d2vkua_: