Lineage for d2vkqa_ (2vkq A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920211Family c.108.1.21: Pyrimidine 5'-nucleotidase (UMPH-1) [142183] (2 proteins)
    Pfam PF05822; the insertion subdomain is a rudiment 4-helical bundle
  6. 2920230Protein automated matches [190392] (2 species)
    not a true protein
  7. 2920231Species Human (Homo sapiens) [TaxId:9606] [187255] (2 PDB entries)
  8. 2920233Domain d2vkqa_: 2vkq A: [153228]
    automated match to d2cn1a1
    complexed with bef, mg

Details for d2vkqa_

PDB Entry: 2vkq (more details), 2.5 Å

PDB Description: crystal structure of human cytosolic 5'-nucleotidase iii ( cn-iii, nt5c3) in complex with beryllium trifluoride
PDB Compounds: (A:) Cytosolic 5'-nucleotidase III

SCOPe Domain Sequences for d2vkqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vkqa_ c.108.1.21 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nptrveeiicglikggaaklqiitdfdmtlsrfsykgkrcptchniidncklvtdecrkk
llqlkekyyaievdpvltveekypymvewytkshgllvqqalpkaklkeivaesdvmlke
gyenffdklqqhsipvfifsagigdvleevirqagvyhpnvkvvsnfmdfdetgvlkgfk
gelihvfnkhdgalrnteyfnqlkdnsniillgdsqgdlrmadgvanvehilkigylndr
vdellekymdsydivlvqdeslevansilqkil

SCOPe Domain Coordinates for d2vkqa_:

Click to download the PDB-style file with coordinates for d2vkqa_.
(The format of our PDB-style files is described here.)

Timeline for d2vkqa_: