SCOP 1.75: Domain d2vkga1: 2vkg A:2-63

Lineage for d2vkga1 (2vkg A:2-63)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.230: Dodecin subunit-like [88797] (6 superfamilies)
   beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132

4. Superfamily d.230.2: Dodecin-like [89807] (1 family)

5. Family d.230.2.1: Dodecin-like [89808] (2 proteins)
   Subunit assembly and a probable biological unit is a dodecamer, hence the name

6. Protein Flavin-binding protein dodecin [89809] (1 species)

7. Species Archaeon Halobacterium salinarum [TaxId:2242] [89810] (12 PDB entries)

8. Domain d2vkga1: 2vkg A:2-63 [153224]
   automatically matched to 2VKF A:2-63
   complexed with cf4, cl, mg, na, so4; mutant

Details for d2vkga1

PDB Entry: 2vkg, 1.8 Å

PDB Description: complexes of dodecin with flavin and flavin-like ligands

PDB Compounds: (A:) dodecin

SCOP Domain Sequences for d2vkga1:

Sequence; same for both SEQRES and ATOM records:

>d2vkga1 d.230.2.1 (A:2-63) Flavin-binding protein dodecin {Archaeon Halobacterium salinarum [TaxId: 2242]}
vfkkvlltgtseesftaaaddaidraedtldnvvwaevvdqgvaigavrtyqtevqvafe
ld

Timeline for d2vkga1:

• d2vkga1 is new in SCOP 1.75
  
• d2vkga1 is called d2vkga_ in SCOPe 2.01
  
• d2vkga1 appears in the current release, SCOPe 2.08, called d2vkga_