Lineage for d2vkfa1 (2vkf A:2-63)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3007999Fold d.230: Dodecin subunit-like [88797] (9 superfamilies)
    beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132
  4. 3008035Superfamily d.230.2: Dodecin-like [89807] (2 families) (S)
  5. 3008036Family d.230.2.1: Dodecin-like [89808] (3 proteins)
    Subunit assembly and a probable biological unit is a dodecamer, hence the name
    automatically mapped to Pfam PF07311
  6. 3008037Protein Flavin-binding protein dodecin [89809] (1 species)
  7. 3008038Species Halobacterium salinarum [TaxId:2242] [89810] (2 PDB entries)
  8. 3008039Domain d2vkfa1: 2vkf A:2-63 [153223]
    protein/DNA complex; complexed with cf2, cl, mg, na, so4

Details for d2vkfa1

PDB Entry: 2vkf (more details), 1.7 Å

PDB Description: complexes of dodecin with flavin and flavin-like ligands
PDB Compounds: (A:) dodecin

SCOPe Domain Sequences for d2vkfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vkfa1 d.230.2.1 (A:2-63) Flavin-binding protein dodecin {Halobacterium salinarum [TaxId: 2242]}
vfkkvlltgtseesftaaaddaidraedtldnvvwaevvdqgvaigavrtyqtevqvafe
ld

SCOPe Domain Coordinates for d2vkfa1:

Click to download the PDB-style file with coordinates for d2vkfa1.
(The format of our PDB-style files is described here.)

Timeline for d2vkfa1: