![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.230: Dodecin subunit-like [88797] (9 superfamilies) beta-alpha-beta(2); 2 layers: alpha/beta; antiparallel beta-sheet: order 132 |
![]() | Superfamily d.230.2: Dodecin-like [89807] (2 families) ![]() |
![]() | Family d.230.2.1: Dodecin-like [89808] (3 proteins) Subunit assembly and a probable biological unit is a dodecamer, hence the name automatically mapped to Pfam PF07311 |
![]() | Protein Flavin-binding protein dodecin [89809] (1 species) |
![]() | Species Halobacterium salinarum [TaxId:2242] [89810] (2 PDB entries) |
![]() | Domain d2vkfa1: 2vkf A:2-63 [153223] protein/DNA complex; complexed with cf2, cl, mg, na, so4 |
PDB Entry: 2vkf (more details), 1.7 Å
SCOPe Domain Sequences for d2vkfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vkfa1 d.230.2.1 (A:2-63) Flavin-binding protein dodecin {Halobacterium salinarum [TaxId: 2242]} vfkkvlltgtseesftaaaddaidraedtldnvvwaevvdqgvaigavrtyqtevqvafe ld
Timeline for d2vkfa1: