Lineage for d2vk9a1 (2vk9 A:2-541)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2133075Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2133076Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2133931Family c.68.1.22: Glycosylating toxin catalytic domain-like [159726] (4 protein domains)
    contains Glycosyltransferase sugar-binding region containing DXD motif, Pfam PF04488
  6. 2133932Protein Alpha-toxin [159729] (1 species)
  7. 2133933Species Clostridium novyi [TaxId:1542] [159730] (1 PDB entry)
    Uniprot Q46149 2-541
  8. 2133934Domain d2vk9a1: 2vk9 A:2-541 [153217]

Details for d2vk9a1

PDB Entry: 2vk9 (more details), 2.85 Å

PDB Description: crystal structure of the catalytic domain of alpha-toxin from clostridium novyi
PDB Compounds: (A:) alpha-toxin

SCOPe Domain Sequences for d2vk9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vk9a1 c.68.1.22 (A:2-541) Alpha-toxin {Clostridium novyi [TaxId: 1542]}
litreqlmkiasiplkrkepeynlildalenfnrdiegtsvkeiysklsklnelvdnyqt
kypssgrnlalenfrdslyselreliknsrtstiasknlsfiwiggpisdqsleyynmwk
mfnkdynirlfydknsllvntlktaiiqesskviieqnqsnildgtyghnkfysdrmkli
yrykrelkmlyenmkqnnsvddiiinflsnyfkydigklnnqkennnnkmiaigatdint
eniltnklksyyyqeliqtnnlaaasdilriailkkyggvycdldflpgvnlslfndisk
pngmdsnyweaaifeaianekklmnnypykymeqvpseikerilsfvrnhdindlilplg
dikisqleillsrlkaatgkktfsnafiisnndsltlnnlisqlenryeilnsiiqekfk
icetydsyinsvselvlettpknlsmdgssfyqqiigylssgfkpevnstvffsgpniys
satcdtyhfikntfdmlssqnqeifeasnnlyfskthdefksswllrsniaekefqklik

SCOPe Domain Coordinates for d2vk9a1:

Click to download the PDB-style file with coordinates for d2vk9a1.
(The format of our PDB-style files is described here.)

Timeline for d2vk9a1: