| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (1 family) ![]() |
| Family b.1.4.1: beta-Galactosidase/glucuronidase domain [49304] (4 proteins) |
| Protein Beta-mannosidase, domains 2, 4 and 5 [158905] (1 species) truncated domain 5 lacks the last strand |
| Species Bacteroides thetaiotaomicron [TaxId:818] [158906] (9 PDB entries) Uniprot Q8AAK6 220-330! Uniprot Q8AAK6 679-783! Uniprot Q8AAK6 784-864 |
| Domain d2vjxb1: 2vjx B:220-330 [153208] Other proteins in same PDB: d2vjxa4, d2vjxa5, d2vjxb4, d2vjxb5 automatically matched to 2JE8 A:220-330 complexed with br, cl, edo, ifl |
PDB Entry: 2vjx (more details), 1.85 Å
SCOP Domain Sequences for d2vjxb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vjxb1 b.1.4.1 (B:220-330) Beta-mannosidase, domains 2, 4 and 5 {Bacteroides thetaiotaomicron [TaxId: 818]}
iatisdyyvrqlsltdenarlsnelivnqivpqkipaevrvnvslngttvtevkqqvtlq
pginhitlpaevtnpvrwmpngwgtptlydfsaqiacgdrivaeqshrigl
Timeline for d2vjxb1: