Lineage for d2vjva1 (2vjv A:6-130)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2956175Superfamily d.58.57: Transposase IS200-like [143422] (1 family) (S)
    contains extra N-terminal hairpin and C-terminal helix, both are involved in dimerization; there can be helix-swapping in the dimer
    automatically mapped to Pfam PF01797
  5. 2956176Family d.58.57.1: Transposase IS200-like [143423] (4 proteins)
    Pfam PF01797
  6. 2956177Protein ISHP608 transposase [143426] (1 species)
  7. 2956178Species Helicobacter pylori [TaxId:210] [143427] (7 PDB entries)
    Uniprot Q933Z0 4-133
  8. 2956179Domain d2vjva1: 2vjv A:6-130 [153201]
    automatically matched to d2a6ma1
    protein/DNA complex; complexed with mg

Details for d2vjva1

PDB Entry: 2vjv (more details), 1.9 Å

PDB Description: crystal structure of the is608 transposase in complex with left end 26-mer dna hairpin and a 6-mer dna representing the left end cleavage site
PDB Compounds: (A:) transposase orfa

SCOPe Domain Sequences for d2vjva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vjva1 d.58.57.1 (A:6-130) ISHP608 transposase {Helicobacter pylori [TaxId: 210]}
lyksnhnvvysckyhivwcpkyrrkvlvgavemrlkeiiqevakelrveiiemqtdkdhi
hiladidpsfgvmkfiktakgrssrilrqefnhlktklptlwtnscfistvggaplnvvk
qyien

SCOPe Domain Coordinates for d2vjva1:

Click to download the PDB-style file with coordinates for d2vjva1.
(The format of our PDB-style files is described here.)

Timeline for d2vjva1: