Lineage for d2vjkb_ (2vjk B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2922183Fold c.123: CoA-transferase family III (CaiB/BaiF) [89795] (1 superfamily)
    consist of two different alpha/beta domains; N-terminal domain has a SurE-like topology with a left-handed beta-alpha-beta unit
  4. 2922184Superfamily c.123.1: CoA-transferase family III (CaiB/BaiF) [89796] (2 families) (S)
  5. 2922185Family c.123.1.1: CoA-transferase family III (CaiB/BaiF) [89797] (5 proteins)
    forms interlocked homodimer of two ring-like subunits
  6. 2922253Protein automated matches [190402] (3 species)
    not a true protein
  7. 2922260Species Oxalobacter formigenes [TaxId:847] [187276] (7 PDB entries)
  8. 2922268Domain d2vjkb_: 2vjk B: [153195]
    automated match to d1p5ha_
    complexed with cl, coa, mg

Details for d2vjkb_

PDB Entry: 2vjk (more details), 1.97 Å

PDB Description: formyl-coa transferase with aspartyl-coa thioester intermediate derived from oxalyl-coa
PDB Compounds: (B:) Formyl-coenzyme A transferase

SCOPe Domain Sequences for d2vjkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vjkb_ c.123.1.1 (B:) automated matches {Oxalobacter formigenes [TaxId: 847]}
tkpldginvldfthvqagpactqmmgflganvikierrgsgdmtrgwlqdkpnvdslyft
mfncnkrsieldmktpegkelleqmikkadvmvenfgpgaldrmgftweyiqelnprvil
asvkgyaeghanehlkvyenvaqcsggaaattgfwdgpptvsgaalgdsnsgmhlmigil
aaleirhktgrgqkvavamqdavlnlvriklrdqqrlertgilaeypqaqpnfafdrdgn
plsfdnitsvprggnaggggqpgwmlkckgwetdadsyvyftiaanmwpqicdmidkpew
kddpayntfegrvdklmdifsfietkfadkdkfevtewaaqygipcgpvmsmkelahdps
lqkvgtvvevvdeirgnhltvgapfkfsgfqpeitrapllgehtdevlkelglddakike
lhakqvv

SCOPe Domain Coordinates for d2vjkb_:

Click to download the PDB-style file with coordinates for d2vjkb_.
(The format of our PDB-style files is described here.)

Timeline for d2vjkb_: