Lineage for d2vj1b_ (2vj1 B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2057856Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 protein domains)
  6. 2058054Protein automated matches [190384] (19 species)
    not a true protein
  7. 2058106Species Human sars coronavirus [TaxId:227859] [187234] (2 PDB entries)
  8. 2058110Domain d2vj1b_: 2vj1 B: [153179]
    automated match to d1uj1a_
    complexed with bez, dms, xp1

Details for d2vj1b_

PDB Entry: 2vj1 (more details), 2.25 Å

PDB Description: a structural view of the inactivation of the sars-coronavirus main proteinase by benzotriazole esters
PDB Compounds: (B:) sars coronavirus main proteinase

SCOPe Domain Sequences for d2vj1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vj1b_ b.47.1.4 (B:) automated matches {Human sars coronavirus [TaxId: 227859]}
gfrkmafpsgkvegcmvqvtcgtttlnglwlddtvycprhvictaedmlnpnyedllirk
snhsflvqagnvqlrvighsmqncllrlkvdtsnpktpkykfvriqpgqtfsvlacyngs
psgvyqcamrpnhtikgsflngscgsvgfnidydcvsfcymhhmelptgvhagtdlegkf
ygpfvdrqtaqaagtdttitlnvlawlyaavingdrwflnrftttlndfnlvamkynyep
ltqdhvdilgplsaqtgiavldmcaalkellqngmngrtilgstiledeftpfdvvrqcs

SCOPe Domain Coordinates for d2vj1b_:

Click to download the PDB-style file with coordinates for d2vj1b_.
(The format of our PDB-style files is described here.)

Timeline for d2vj1b_: