Lineage for d2vj0a2 (2vj0 A:825-938)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968220Fold d.105: Subdomain of clathrin and coatomer appendage domain [55710] (1 superfamily)
    beta-alpha-beta-alpha-beta(4)-alpha; 3 layers: a/b/a; bifurcated antiparallel beta-sheet
  4. 2968221Superfamily d.105.1: Subdomain of clathrin and coatomer appendage domain [55711] (2 families) (S)
  5. 2968222Family d.105.1.1: Clathrin adaptor appendage, alpha and beta chain-specific domain [55712] (2 proteins)
  6. 2968223Protein Alpa-adaptin AP2, C-terminal subdomain [55713] (1 species)
  7. 2968224Species Mouse (Mus musculus) [TaxId:10090] [55714] (10 PDB entries)
    Uniprot P17427 694-938 # 98% sequence identity
  8. 2968228Domain d2vj0a2: 2vj0 A:825-938 [153177]
    Other proteins in same PDB: d2vj0a1
    automatically matched to d1b9ka2
    complexed with ben, cl, dtd, so4

Details for d2vj0a2

PDB Entry: 2vj0 (more details), 1.6 Å

PDB Description: crystal structure of the alpha-adaptin appendage domain, from the ap2 adaptor complex, in complex with an fxdnf peptide from amphiphysin1 and a wvxf peptide from synaptojanin p170
PDB Compounds: (A:) ap-2 complex subunit alpha-2

SCOPe Domain Sequences for d2vj0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vj0a2 d.105.1.1 (A:825-938) Alpa-adaptin AP2, C-terminal subdomain {Mouse (Mus musculus) [TaxId: 10090]}
ffqptemasqdffqrwkqlsnpqqevqnifkakhpmdteitkakiigfgsalleevdpnp
anfvgagiihtkttqigcllrlepnlqaqmyrltlrtskdtvsqrlcellseqf

SCOPe Domain Coordinates for d2vj0a2:

Click to download the PDB-style file with coordinates for d2vj0a2.
(The format of our PDB-style files is described here.)

Timeline for d2vj0a2: