SCOPe 2.07: Domain d2vj0a1: 2vj0 A:694-824

Lineage for d2vj0a1 (2vj0 A:694-824)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (4 families)
   contains an additional N-terminal strand

5. Family b.1.10.1: Alpha-adaptin ear subdomain-like [49349] (2 proteins)
   ear domain consists of two different subdomains
   automatically mapped to Pfam PF02883

6. Protein Alpha-adaptin AP2 ear domain, N-terminal subdomain [49350] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [49351] (10 PDB entries)
   Uniprot P17427 694-938 # 98% sequence identity

8. Domain d2vj0a1: 2vj0 A:694-824 [153176]
   Other proteins in same PDB: d2vj0a2
   automatically matched to d1w80a1
   complexed with ben, cl, dtd, so4

Details for d2vj0a1

PDB Entry: 2vj0, 1.6 Å

PDB Description: crystal structure of the alpha-adaptin appendage domain, from the ap2 adaptor complex, in complex with an fxdnf peptide from amphiphysin1 and a wvxf peptide from synaptojanin p170

PDB Compounds: (A:) ap-2 complex subunit alpha-2

SCOPe Domain Sequences for d2vj0a1:

Sequence; same for both SEQRES and ATOM records:

>d2vj0a1 b.1.10.1 (A:694-824) Alpha-adaptin AP2 ear domain, N-terminal subdomain {Mouse (Mus musculus) [TaxId: 10090]}
laplapgsednfarfvcknngvlfenqllqiglksefrqnlgrmfifygnktstqflnft
ptlicaddlqtnlnlqtkpvdptvdggaqvqqviniecisdfteapvlniqfryggtfqn
vsvklpitlnk

Timeline for d2vj0a1:

• d2vj0a1 first appeared in SCOP 1.75
  
• d2vj0a1 appears in SCOPe 2.06
  
• d2vj0a1 appears in the current release, SCOPe 2.08