![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.10: Clathrin adaptor appendage domain [49348] (4 families) ![]() contains an additional N-terminal strand |
![]() | Family b.1.10.1: Alpha-adaptin ear subdomain-like [49349] (2 proteins) ear domain consists of two different subdomains automatically mapped to Pfam PF02883 |
![]() | Protein Alpha-adaptin AP2 ear domain, N-terminal subdomain [49350] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [49351] (10 PDB entries) Uniprot P17427 694-938 # 98% sequence identity |
![]() | Domain d2vj0a1: 2vj0 A:693-824 [153176] Other proteins in same PDB: d2vj0a2 automatically matched to d1w80a1 complexed with ben, cl, dtd, so4 |
PDB Entry: 2vj0 (more details), 1.6 Å
SCOPe Domain Sequences for d2vj0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vj0a1 b.1.10.1 (A:693-824) Alpha-adaptin AP2 ear domain, N-terminal subdomain {Mouse (Mus musculus) [TaxId: 10090]} ilaplapgsednfarfvcknngvlfenqllqiglksefrqnlgrmfifygnktstqflnf tptlicaddlqtnlnlqtkpvdptvdggaqvqqviniecisdfteapvlniqfryggtfq nvsvklpitlnk
Timeline for d2vj0a1: