Lineage for d2viva_ (2viv A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2387558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2387559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2387819Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2389542Protein automated matches [190044] (14 species)
    not a true protein
  7. 2389583Species Human (Homo sapiens) [TaxId:9606] [187233] (146 PDB entries)
  8. 2389652Domain d2viva_: 2viv A: [153174]
    automated match to d2vipa1
    complexed with act, vg2

Details for d2viva_

PDB Entry: 2viv (more details), 1.72 Å

PDB Description: fragment-based discovery of mexiletine derivatives as orally bioavailable inhibitors of urokinase-type plasminogen activator
PDB Compounds: (A:) urokinase-type plasminogen activator chain b

SCOPe Domain Sequences for d2viva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2viva_ b.47.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iiggefttienqpwfaaiyrrhrggsvtyvcggslispcwvisathcfidypkkedyivy
lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
slpsmyndpqfgtsceitgfgkenstdylypeqlkmtvvklishrecqqphyygsevttk
mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
irshtkee

SCOPe Domain Coordinates for d2viva_:

Click to download the PDB-style file with coordinates for d2viva_.
(The format of our PDB-style files is described here.)

Timeline for d2viva_: