Lineage for d2vipa_ (2vip A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2404432Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2406349Protein automated matches [190044] (14 species)
    not a true protein
  7. 2406399Species Human (Homo sapiens) [TaxId:9606] [187233] (166 PDB entries)
  8. 2406488Domain d2vipa_: 2vip A: [153172]
    automated match to d2vipa1
    complexed with act, l1r, so4

Details for d2vipa_

PDB Entry: 2vip (more details), 1.72 Å

PDB Description: fragment-based discovery of mexiletine derivatives as orally bioavailable inhibitors of urokinase-type plasminogen activator
PDB Compounds: (A:) urokinase-type plasminogen activator chain b

SCOPe Domain Sequences for d2vipa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vipa_ b.47.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iiggefttienqpwfaaiyrrhrggsvtyvcggslispcwvisathcfidypkkedyivy
lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
slpsmyndpqfgtsceitgfgkenstdylypeqlkmtvvklishrecqqphyygsevttk
mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
irshtkee

SCOPe Domain Coordinates for d2vipa_:

Click to download the PDB-style file with coordinates for d2vipa_.
(The format of our PDB-style files is described here.)

Timeline for d2vipa_: