SCOP 1.75: Domain d2vipa1: 2vip A:16-244

Lineage for d2vipa1 (2vip A:16-244)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)

6. Protein Urokinase-type plasminogen activator (LMW U-PA), catalytic domain [50586] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50587] (49 PDB entries)
   Uniprot P00749 156-178,179-424

8. Domain d2vipa1: 2vip A:16-244 [153172]
   automatically matched to d1ejna_
   complexed with act, l1r, so4; mutant

Details for d2vipa1

PDB Entry: 2vip, 1.72 Å

PDB Description: fragment-based discovery of mexiletine derivatives as orally bioavailable inhibitors of urokinase-type plasminogen activator

PDB Compounds: (A:) urokinase-type plasminogen activator chain b

SCOP Domain Sequences for d2vipa1:

Sequence; same for both SEQRES and ATOM records:

>d2vipa1 b.47.1.2 (A:16-244) Urokinase-type plasminogen activator (LMW U-PA), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
iiggefttienqpwfaaiyrrhrggsvtyvcggslispcwvisathcfidypkkedyivy
lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
slpsmyndpqfgtsceitgfgkenstdylypeqlkmtvvklishrecqqphyygsevttk
mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
irshtke

Timeline for d2vipa1:

• d2vipa1 is new in SCOP 1.75
  
• d2vipa1 appears in SCOPe 2.01
  
• d2vipa1 appears in the current release, SCOPe 2.08, called d2vipa_