SCOPe 2.07: Domain d2vina_: 2vin A:

Lineage for d2vina_ (2vin A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein automated matches [190044] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187233] (166 PDB entries)

8. Domain d2vina_: 2vin A: [153170]
   automated match to d2vipa1
   complexed with 505, act, so4

Details for d2vina_

PDB Entry: 2vin, 1.9 Å

PDB Description: fragment-based discovery of mexiletine derivatives as orally bioavailable inhibitors of urokinase-type plasminogen activator

PDB Compounds: (A:) urokinase-type plasminogen activator chain b

SCOPe Domain Sequences for d2vina_:

Sequence; same for both SEQRES and ATOM records:

>d2vina_ b.47.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iiggefttienqpwfaaiyrrhrggsvtyvcggslispcwvisathcfidypkkedyivy
lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
slpsmyndpqfgtsceitgfgkenstdylypeqlkmtvvklishrecqqphyygsevttk
mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
irshtkee

Timeline for d2vina_:

• d2vina_ first appeared in SCOP 1.75, called d2vina1
  
• d2vina_ appears in SCOPe 2.06
  
• d2vina_ appears in the current release, SCOPe 2.08