Lineage for d2vicb1 (2vic B:6-131)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1030373Superfamily d.58.57: Transposase IS200-like [143422] (1 family) (S)
    contains extra N-terminal hairpin and C-terminal helix, both are involved in dimerization; there can be helix-swapping in the dimer
  5. 1030374Family d.58.57.1: Transposase IS200-like [143423] (4 proteins)
    Pfam PF01797
  6. 1030375Protein ISHP608 transposase [143426] (1 species)
  7. 1030376Species Helicobacter pylori [TaxId:210] [143427] (7 PDB entries)
    Uniprot Q933Z0 4-133
  8. 1030384Domain d2vicb1: 2vic B:6-131 [153167]
    automatically matched to d2a6ma1
    protein/DNA complex; complexed with mn

Details for d2vicb1

PDB Entry: 2vic (more details), 2.35 Å

PDB Description: crystal structure of the ishp608 transposase in complex with left end 26-mer dna and manganese
PDB Compounds: (B:) transposase orfa

SCOPe Domain Sequences for d2vicb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vicb1 d.58.57.1 (B:6-131) ISHP608 transposase {Helicobacter pylori [TaxId: 210]}
lyksnhnvvysckyhivwcpkyrrkvlvgavemrlkeiiqevakelrveiiemqtdkdhi
hiladidpsfgvmkfiktakgrssrilrqefnhlktklptlwtnscfistvggaplnvvk
qyienq

SCOPe Domain Coordinates for d2vicb1:

Click to download the PDB-style file with coordinates for d2vicb1.
(The format of our PDB-style files is described here.)

Timeline for d2vicb1: