SCOPe 2.08: Domain d2vicb1: 2vic B:6-131

Lineage for d2vicb1 (2vic B:6-131)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.57: Transposase IS200-like [143422] (1 family)
   contains extra N-terminal hairpin and C-terminal helix, both are involved in dimerization; there can be helix-swapping in the dimer
   automatically mapped to Pfam PF01797

5. Family d.58.57.1: Transposase IS200-like [143423] (4 proteins)
   Pfam PF01797

6. Protein ISHP608 transposase [143426] (1 species)

7. Species Helicobacter pylori [TaxId:210] [143427] (7 PDB entries)
   Uniprot Q933Z0 4-133

8. Domain d2vicb1: 2vic B:6-131 [153167]
   automatically matched to d2a6ma1
   protein/DNA complex; complexed with mn

Details for d2vicb1

PDB Entry: 2vic, 2.35 Å

PDB Description: crystal structure of the ishp608 transposase in complex with left end 26-mer dna and manganese

PDB Compounds: (B:) transposase orfa

SCOPe Domain Sequences for d2vicb1:

Sequence; same for both SEQRES and ATOM records:

>d2vicb1 d.58.57.1 (B:6-131) ISHP608 transposase {Helicobacter pylori [TaxId: 210]}
lyksnhnvvysckyhivwcpkyrrkvlvgavemrlkeiiqevakelrveiiemqtdkdhi
hiladidpsfgvmkfiktakgrssrilrqefnhlktklptlwtnscfistvggaplnvvk
qyienq

Timeline for d2vicb1:

• d2vicb1 first appeared in SCOP 1.75
  
• d2vicb1 appears in SCOPe 2.07