Lineage for d2vhpt1 (2vhp T:2-86)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 908235Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 908369Superfamily a.7.6: Ribosomal protein S20 [46992] (1 family) (S)
  5. 908370Family a.7.6.1: Ribosomal protein S20 [46993] (1 protein)
    this is a repeat family; one repeat unit is 2gyb T:4-86 found in domain
  6. 908371Protein Ribosomal protein S20 [46994] (2 species)
  7. 908372Species Escherichia coli [TaxId:562] [158365] (26 PDB entries)
    Uniprot P0A7U7 2-86
  8. 908396Domain d2vhpt1: 2vhp T:2-86 [153164]
    Other proteins in same PDB: d2vhpb1, d2vhpc1, d2vhpc2, d2vhpd1, d2vhpe1, d2vhpe2, d2vhpf1, d2vhpg1, d2vhph1, d2vhpi1, d2vhpj1, d2vhpk1, d2vhpl1, d2vhpm1, d2vhpn1, d2vhpo1, d2vhpp1, d2vhpq1, d2vhpr1, d2vhps1, d2vhpu1
    automatically matched to 2AVY T:2-86
    protein/RNA complex; complexed with mg

Details for d2vhpt1

PDB Entry: 2vhp (more details), 3.74 Å

PDB Description: Structure of PDF binding helix in complex with the ribosome (part 4 of 4)
PDB Compounds: (T:) 30S ribosomal protein S20

SCOPe Domain Sequences for d2vhpt1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vhpt1 a.7.6.1 (T:2-86) Ribosomal protein S20 {Escherichia coli [TaxId: 562]}
niksakkraiqsekarkhnasrrsmmrtfikkvyaaieagdkaaaqkafnemqpivdrqa
akglihknkaarhkanltaqinkla

SCOPe Domain Coordinates for d2vhpt1:

Click to download the PDB-style file with coordinates for d2vhpt1.
(The format of our PDB-style files is described here.)

Timeline for d2vhpt1: