Lineage for d2vhpm1 (2vhp M:1-114)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1284575Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
    core: 3-4 helices
  4. 1284576Superfamily a.156.1: S13-like H2TH domain [46946] (3 families) (S)
    contains a helix-two turns-helix (H2TH) motif
  5. 1284577Family a.156.1.1: Ribosomal protein S13 [46947] (1 protein)
    contains 3 helices and a beta-hairpin in the core and a non-globular C-terminal extension
    automatically mapped to Pfam PF00416
  6. 1284578Protein Ribosomal protein S13 [46948] (2 species)
  7. 1284579Species Escherichia coli [TaxId:562] [158360] (26 PDB entries)
    Uniprot P0A7S9 1-114
  8. 1284603Domain d2vhpm1: 2vhp M:1-114 [153157]
    Other proteins in same PDB: d2vhpb1, d2vhpc1, d2vhpc2, d2vhpd1, d2vhpe1, d2vhpe2, d2vhpf1, d2vhpg1, d2vhph1, d2vhpi1, d2vhpj1, d2vhpk1, d2vhpl1, d2vhpn1, d2vhpo1, d2vhpp1, d2vhpq1, d2vhpr1, d2vhps1, d2vhpt1, d2vhpu1
    automatically matched to 2AVY M:1-114
    protein/RNA complex; complexed with mg

Details for d2vhpm1

PDB Entry: 2vhp (more details), 3.74 Å

PDB Description: Structure of PDF binding helix in complex with the ribosome (part 4 of 4)
PDB Compounds: (M:) 30S ribosomal protein S13

SCOPe Domain Sequences for d2vhpm1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vhpm1 a.156.1.1 (M:1-114) Ribosomal protein S13 {Escherichia coli [TaxId: 562]}
ariaginipdhkhavialtsiygvgktrskailaaagiaedvkiselsegqidtlrdeva
kfvvegdlrreismsikrlmdlgcyrglrhrrglpvrgqrtktnartrkgprkp

SCOPe Domain Coordinates for d2vhpm1:

Click to download the PDB-style file with coordinates for d2vhpm1.
(The format of our PDB-style files is described here.)

Timeline for d2vhpm1: