SCOP 1.75: Domain d2vhpg1: 2vhp G:2-151

Lineage for d2vhpg1 (2vhp G:2-151)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.75: Ribosomal protein S7 [47972] (1 superfamily)
   core: 5 helices; contains one more helix and a beta-hairpin outside the core

4. Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family)

5. Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein)

6. Protein Ribosomal protein S7 [47975] (4 species)

7. Species Escherichia coli [TaxId:562] [158599] (24 PDB entries)
   Uniprot P02359 2-151

8. Domain d2vhpg1: 2vhp G:2-151 [153151]
   Other proteins in same PDB: d2vhpb1, d2vhpc1, d2vhpc2, d2vhpd1, d2vhpe1, d2vhpe2, d2vhpf1, d2vhph1, d2vhpi1, d2vhpj1, d2vhpk1, d2vhpl1, d2vhpm1, d2vhpn1, d2vhpo1, d2vhpp1, d2vhpq1, d2vhpr1, d2vhps1, d2vhpt1, d2vhpu1
   automatically matched to 2AVY G:2-151
   complexed with mg

Details for d2vhpg1

PDB Entry: 2vhp, 3.74 Å

PDB Description: Structure of PDF binding helix in complex with the ribosome (part 4 of 4)

PDB Compounds: (G:) 30S ribosomal protein S7

SCOP Domain Sequences for d2vhpg1:

Sequence; same for both SEQRES and ATOM records:

>d2vhpg1 a.75.1.1 (G:2-151) Ribosomal protein S7 {Escherichia coli [TaxId: 562]}
rrrvigqrkilpdpkfgsellakfvnilmvdgkkstaesivysaletlaqrsgkseleaf
evalenvrptvevksrrvggstyqvpvevrpvrrnalamrwiveaarkrgdksmalrlan
elsdaaenkgtavkkredvhrmaeankafa

Timeline for d2vhpg1:

• d2vhpg1 is new in SCOP 1.75
  
• d2vhpg1 appears in SCOPe 2.01
  
• d2vhpg1 appears in the current release, SCOPe 2.08