Lineage for d2vhom1 (2vho M:1-114)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1752104Fold a.156: S13-like H2TH domain [81297] (1 superfamily)
    core: 3-4 helices
  4. 1752105Superfamily a.156.1: S13-like H2TH domain [46946] (4 families) (S)
    contains a helix-two turns-helix (H2TH) motif
  5. 1752106Family a.156.1.1: Ribosomal protein S13 [46947] (1 protein)
    contains 3 helices and a beta-hairpin in the core and a non-globular C-terminal extension
    automatically mapped to Pfam PF00416
  6. 1752107Protein Ribosomal protein S13 [46948] (2 species)
  7. 1752108Species Escherichia coli [TaxId:562] [158360] (26 PDB entries)
    Uniprot P0A7S9 1-114
  8. 1752125Domain d2vhom1: 2vho M:1-114 [153135]
    Other proteins in same PDB: d2vhob1, d2vhoc1, d2vhoc2, d2vhod1, d2vhoe1, d2vhoe2, d2vhof1, d2vhog1, d2vhoh1, d2vhoi1, d2vhoj1, d2vhok1, d2vhol1, d2vhon1, d2vhoo1, d2vhop1, d2vhoq1, d2vhor1, d2vhos1, d2vhot1, d2vhou1
    protein/RNA complex; complexed with mg
    protein/RNA complex; complexed with mg

Details for d2vhom1

PDB Entry: 2vho (more details), 3.74 Å

PDB Description: Structure of PDF binding helix in complex with the ribosome (part 3 of 4)
PDB Compounds: (M:) 30S ribosomal protein S13

SCOPe Domain Sequences for d2vhom1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vhom1 a.156.1.1 (M:1-114) Ribosomal protein S13 {Escherichia coli [TaxId: 562]}
ariaginipdhkhavialtsiygvgktrskailaaagiaedvkiselsegqidtlrdeva
kfvvegdlrreismsikrlmdlgcyrglrhrrglpvrgqrtktnartrkgprkp

SCOPe Domain Coordinates for d2vhom1:

Click to download the PDB-style file with coordinates for d2vhom1.
(The format of our PDB-style files is described here.)

Timeline for d2vhom1: