![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.75: Ribosomal protein S7 [47972] (1 superfamily) core: 5 helices; contains one more helix and a beta-hairpin outside the core |
![]() | Superfamily a.75.1: Ribosomal protein S7 [47973] (1 family) ![]() |
![]() | Family a.75.1.1: Ribosomal protein S7 [47974] (1 protein) |
![]() | Protein Ribosomal protein S7 [47975] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [158599] (24 PDB entries) Uniprot P02359 2-151 |
![]() | Domain d2vhog1: 2vho G:2-151 [153129] Other proteins in same PDB: d2vhob1, d2vhoc1, d2vhoc2, d2vhod1, d2vhoe1, d2vhoe2, d2vhof1, d2vhoh1, d2vhoi1, d2vhoj1, d2vhok1, d2vhol1, d2vhom1, d2vhon1, d2vhoo1, d2vhop1, d2vhoq1, d2vhor1, d2vhos1, d2vhot1, d2vhou1 protein/RNA complex; complexed with mg protein/RNA complex; complexed with mg |
PDB Entry: 2vho (more details), 3.74 Å
SCOPe Domain Sequences for d2vhog1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vhog1 a.75.1.1 (G:2-151) Ribosomal protein S7 {Escherichia coli [TaxId: 562]} rrrvigqrkilpdpkfgsellakfvnilmvdgkkstaesivysaletlaqrsgkseleaf evalenvrptvevksrrvggstyqvpvevrpvrrnalamrwiveaarkrgdksmalrlan elsdaaenkgtavkkredvhrmaeankafa
Timeline for d2vhog1: