Lineage for d2vhof1 (2vho F:1-100)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1028924Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) (S)
  5. 1028925Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein)
  6. 1028926Protein Ribosomal protein S6 [54997] (4 species)
  7. 1028929Species Escherichia coli [TaxId:562] [160317] (24 PDB entries)
    Uniprot P02358 1-100
  8. 1028950Domain d2vhof1: 2vho F:1-100 [153128]
    Other proteins in same PDB: d2vhob1, d2vhoc1, d2vhoc2, d2vhod1, d2vhoe1, d2vhoe2, d2vhog1, d2vhoh1, d2vhoi1, d2vhoj1, d2vhok1, d2vhol1, d2vhom1, d2vhon1, d2vhoo1, d2vhop1, d2vhoq1, d2vhor1, d2vhos1, d2vhot1, d2vhou1
    automatically matched to 2AVY F:1-100
    protein/RNA complex; complexed with mg

Details for d2vhof1

PDB Entry: 2vho (more details), 3.74 Å

PDB Description: Structure of PDF binding helix in complex with the ribosome (part 3 of 4)
PDB Compounds: (F:) 30S ribosomal protein S6

SCOPe Domain Sequences for d2vhof1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vhof1 d.58.14.1 (F:1-100) Ribosomal protein S6 {Escherichia coli [TaxId: 562]}
mrhyeivfmvhpdqseqvpgmierytaaitgaegkihrledwgrrqlaypinklhkahyv
lmnveapqevidelettfrfndavirsmvmrtkhavteas

SCOPe Domain Coordinates for d2vhof1:

Click to download the PDB-style file with coordinates for d2vhof1.
(The format of our PDB-style files is described here.)

Timeline for d2vhof1: