Lineage for d2vhob1 (2vho B:8-225)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1837702Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1840244Superfamily c.23.15: Ribosomal protein S2 [52313] (1 family) (S)
    fold elaborated with additional structures
  5. 1840245Family c.23.15.1: Ribosomal protein S2 [52314] (1 protein)
  6. 1840246Protein Ribosomal protein S2 [52315] (3 species)
  7. 1840256Species Escherichia coli [TaxId:562] [159491] (26 PDB entries)
    Uniprot P0A7V0 8-225
  8. 1840273Domain d2vhob1: 2vho B:8-225 [153122]
    Other proteins in same PDB: d2vhoc1, d2vhoc2, d2vhod1, d2vhoe1, d2vhoe2, d2vhof1, d2vhog1, d2vhoh1, d2vhoi1, d2vhoj1, d2vhok1, d2vhol1, d2vhom1, d2vhon1, d2vhoo1, d2vhop1, d2vhoq1, d2vhor1, d2vhos1, d2vhot1, d2vhou1
    protein/RNA complex; complexed with mg
    protein/RNA complex; complexed with mg

Details for d2vhob1

PDB Entry: 2vho (more details), 3.74 Å

PDB Description: Structure of PDF binding helix in complex with the ribosome (part 3 of 4)
PDB Compounds: (B:) 30S ribosomal protein S2

SCOPe Domain Sequences for d2vhob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vhob1 c.23.15.1 (B:8-225) Ribosomal protein S2 {Escherichia coli [TaxId: 562]}
mlkagvhfghqtrywnpkmkpfifgarnkvhiinlektvpmfnealaelnkiasrkgkil
fvgtkraaseavkdaalscdqffvnhrwlggmltnwktvrqsikrlkdletqsqdgtfdk
ltkkealmrtreleklenslggikdmgglpdalfvidadhehiaikeannlgipvfaivd
tnsdpdgvdfvipgnddairavtlylgavaatvregrs

SCOPe Domain Coordinates for d2vhob1:

Click to download the PDB-style file with coordinates for d2vhob1.
(The format of our PDB-style files is described here.)

Timeline for d2vhob1: