Lineage for d2vhni1 (2vhn I:73-141)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1984852Superfamily a.4.7: Ribosomal protein L11, C-terminal domain [46906] (1 family) (S)
  5. 1984853Family a.4.7.1: Ribosomal protein L11, C-terminal domain [46907] (1 protein)
  6. 1984854Protein Ribosomal protein L11, C-terminal domain [46908] (6 species)
  7. 1984872Species Escherichia coli [TaxId:562] [158349] (29 PDB entries)
    Uniprot P0A7J7 73-141
  8. 1984894Domain d2vhni1: 2vhn I:73-141 [153103]
    Other proteins in same PDB: d2vhn01, d2vhn11, d2vhn31, d2vhn41, d2vhnc1, d2vhnc2, d2vhnd1, d2vhne1, d2vhnf1, d2vhng1, d2vhng2, d2vhnh1, d2vhnh2, d2vhni2, d2vhnj1, d2vhnk1, d2vhnl1, d2vhnm1, d2vhnn1, d2vhno1, d2vhnp1, d2vhnq1, d2vhnr1, d2vhns1, d2vhnt1, d2vhnu1, d2vhnv1, d2vhnw1, d2vhnx1, d2vhny1, d2vhnz1
    protein/RNA complex; complexed with mg
    protein/RNA complex; complexed with mg

Details for d2vhni1

PDB Entry: 2vhn (more details), 3.74 Å

PDB Description: Structure of PDF binding helix in complex with the ribosome. (Structure 2 of 4)
PDB Compounds: (I:) 50S ribosomal protein L11

SCOPe Domain Sequences for d2vhni1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vhni1 a.4.7.1 (I:73-141) Ribosomal protein L11, C-terminal domain {Escherichia coli [TaxId: 562]}
ppaavllkkaagiksgsgkpnkdkvgkisraqlqeiaqtkaadmtgadieamtrsiegta
rsmglvved

SCOPe Domain Coordinates for d2vhni1:

Click to download the PDB-style file with coordinates for d2vhni1.
(The format of our PDB-style files is described here.)

Timeline for d2vhni1: