Lineage for d2vhnh2 (2vhn H:1-58)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2208184Fold d.100: MbtH/L9 domain-like [55657] (2 superfamilies)
    beta(2)-alpha-beta-alpha; 3 layers: alpha/beta/alpha
  4. 2208185Superfamily d.100.1: L9 N-domain-like [55658] (3 families) (S)
  5. 2208186Family d.100.1.1: Ribosomal protein L9 N-domain [55659] (1 protein)
    automatically mapped to Pfam PF01281
  6. 2208187Protein Ribosomal protein L9 N-domain [55660] (3 species)
  7. 2208195Species Escherichia coli [TaxId:562] [160581] (29 PDB entries)
    Uniprot P0A7R1 1-58
  8. 2208217Domain d2vhnh2: 2vhn H:1-58 [153102]
    Other proteins in same PDB: d2vhn01, d2vhn11, d2vhn31, d2vhn41, d2vhnc1, d2vhnc2, d2vhnd1, d2vhne1, d2vhnf1, d2vhng1, d2vhng2, d2vhnh1, d2vhni1, d2vhni2, d2vhnj1, d2vhnk1, d2vhnl1, d2vhnm1, d2vhnn1, d2vhno1, d2vhnp1, d2vhnq1, d2vhnr1, d2vhns1, d2vhnt1, d2vhnu1, d2vhnv1, d2vhnw1, d2vhnx1, d2vhny1, d2vhnz1
    protein/RNA complex; complexed with mg
    protein/RNA complex; complexed with mg

Details for d2vhnh2

PDB Entry: 2vhn (more details), 3.74 Å

PDB Description: Structure of PDF binding helix in complex with the ribosome. (Structure 2 of 4)
PDB Compounds: (H:) 50S ribosomal protein L9

SCOPe Domain Sequences for d2vhnh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vhnh2 d.100.1.1 (H:1-58) Ribosomal protein L9 N-domain {Escherichia coli [TaxId: 562]}
mqvilldkvanlgslgdqvnvkagyarnflvpqgkavpatkknieffearraeleakl

SCOPe Domain Coordinates for d2vhnh2:

Click to download the PDB-style file with coordinates for d2vhnh2.
(The format of our PDB-style files is described here.)

Timeline for d2vhnh2: