SCOP 1.75: Domain d2vhng2: 2vhn G:82-176

Lineage for d2vhng2 (2vhn G:82-176)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.141: Ribosomal protein L6 [56052] (1 superfamily)
   consists of two beta-sheets and one alpha-helix packed around single core

4. Superfamily d.141.1: Ribosomal protein L6 [56053] (1 family)

5. Family d.141.1.1: Ribosomal protein L6 [56054] (1 protein)

6. Protein Ribosomal protein L6 [56055] (6 species)
   duplication: consists of two domains of this fold

7. Species Escherichia coli [TaxId:562] [160796] (27 PDB entries)
   Uniprot P02390 1-81! Uniprot P02390 82-176

8. Domain d2vhng2: 2vhn G:82-176 [153100]
   Other proteins in same PDB: d2vhn01, d2vhn11, d2vhn31, d2vhn41, d2vhnc1, d2vhnc2, d2vhnd1, d2vhne1, d2vhnf1, d2vhnh1, d2vhnh2, d2vhni1, d2vhni2, d2vhnj1, d2vhnk1, d2vhnl1, d2vhnm1, d2vhnn1, d2vhno1, d2vhnp1, d2vhnq1, d2vhnr1, d2vhns1, d2vhnt1, d2vhnu1, d2vhnv1, d2vhnw1, d2vhnx1, d2vhny1, d2vhnz1
   automatically matched to 2AW4 G:82-176
   complexed with mg

Details for d2vhng2

PDB Entry: 2vhn, 3.74 Å

PDB Description: Structure of PDF binding helix in complex with the ribosome. (Structure 2 of 4)

PDB Compounds: (G:) 50S ribosomal protein L6

SCOP Domain Sequences for d2vhng2:

Sequence; same for both SEQRES and ATOM records:

>d2vhng2 d.141.1.1 (G:82-176) Ribosomal protein L6 {Escherichia coli [TaxId: 562]}
ftkklqlvgvgyraavkgnvinlslgfshpvdhqlpagitaecptqteivlkgadkqvig
qvaadlrayrrpepykgkgvryadevvrtkeakkk

Timeline for d2vhng2:

• d2vhng2 is new in SCOP 1.75
  
• d2vhng2 appears in SCOPe 2.01
  
• d2vhng2 appears in the current release, SCOPe 2.08